(data stored in ACNUC30630 zone)

EMBL: CU458896.PE33

CU458896.PE33        Location/Qualifiers
FT   CDS             complement(31940..33202)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0034c"
FT                   /product="Putative serine/threonine-protein kinase PknA"
FT                   /note="Similar to Q264W7_MYCVN e-153"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0034c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60136"
FT                   /db_xref="GOA:B1ME72"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME72"
FT                   /protein_id="CAM60136.1"
FT                   /translation="MTVRVGETLSGRYRLQRLIATGGMGQVWEGTDSRLGRKVAVKVLK
FT                   AEFSSDPEFIERFRAEARTVAMLNHPGIASVYDYGETDIDSEGRTAYLVMELIHGEPLN
FT                   SVLKRTGRLSLRHSLDMLEQTGRALQVAHAAGLVHRDVKPGNILITPTGQVKLTDFGIA
FT                   KAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDVYSLGVVGYEAVSGKRPFSGDGA
FT                   LTVAMKHIKETPSPLPADLPPNVRELIEITLVKNPQNRYTSGGPFADAVAAVRAGRRPP
FT                   RPNQAPTISRATPAAIPPATQVRPAVGAPSRVAPPTSRTRQPTGSHRPPPPRRGTFSPG
FT                   QKALMWAAAVLGIFAIIIAALILLQASEKKNQTPSIPATVSGSETPSSPGSASPGALAP
FT                   ANIVALLPDAEPDPIPGTKSP"
     MTVRVGETLS GRYRLQRLIA TGGMGQVWEG TDSRLGRKVA VKVLKAEFSS DPEFIERFRA        60
     EARTVAMLNH PGIASVYDYG ETDIDSEGRT AYLVMELIHG EPLNSVLKRT GRLSLRHSLD       120
     MLEQTGRALQ VAHAAGLVHR DVKPGNILIT PTGQVKLTDF GIAKAVDAAP VTQTGMVMGT       180
     AQYIAPEQAL GHDATPASDV YSLGVVGYEA VSGKRPFSGD GALTVAMKHI KETPSPLPAD       240
     LPPNVRELIE ITLVKNPQNR YTSGGPFADA VAAVRAGRRP PRPNQAPTIS RATPAAIPPA       300
     TQVRPAVGAP SRVAPPTSRT RQPTGSHRPP PPRRGTFSPG QKALMWAAAV LGIFAIIIAA       360
     LILLQASEKK NQTPSIPATV SGSETPSSPG SASPGALAPA NIVALLPDAE PDPIPGTKSP       420
//

If you have problems or comments...

PBIL Back to PBIL home page