(data stored in ACNUC30630 zone)

EMBL: CU458896.PE344

CU458896.PE344       Location/Qualifiers
FT   CDS             345585..346640
FT                   /transl_table=11
FT                   /locus_tag="MAB_0348"
FT                   /product="Hypothetical conserved TPR domain protein"
FT                   /note="Similar to A0QTI3_MYCS2 2e-16"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60447"
FT                   /db_xref="GOA:B1MFP7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFP7"
FT                   /protein_id="CAM60447.1"
FT                   /translation="MTSADDTPLARALMIEELIGIRQYDTARIQLAEALTTWPDEPDLL
FT                   STGAYLDLQLGHYAGAMWYADNALRFDPGNGQAQRIRISVLLRGWNKMPAMAAAQHLVR
FT                   THPNRASSHYMMAVVLYARRHKRAALAAIDEALRIDPDDSSYRNLRGQIVGMRSWKGKA
FT                   LKEFRTALRIDPGNASAMENVGKAQSRRWRLSSALRAYLDLGAMDIRRADDVRAGVSEV
FT                   FNRVVSVMMPVNFLALVILGASAGVATRYGNHQLPIPAQVIAALLAIGVIALPVWMVLT
FT                   VPQRSANALWASLRRSKLISLCVVLGMAIALSLLVVAVIGSRAAAEAALPLIALPVLIV
FT                   FALRLVADFVG"
     MTSADDTPLA RALMIEELIG IRQYDTARIQ LAEALTTWPD EPDLLSTGAY LDLQLGHYAG        60
     AMWYADNALR FDPGNGQAQR IRISVLLRGW NKMPAMAAAQ HLVRTHPNRA SSHYMMAVVL       120
     YARRHKRAAL AAIDEALRID PDDSSYRNLR GQIVGMRSWK GKALKEFRTA LRIDPGNASA       180
     MENVGKAQSR RWRLSSALRA YLDLGAMDIR RADDVRAGVS EVFNRVVSVM MPVNFLALVI       240
     LGASAGVATR YGNHQLPIPA QVIAALLAIG VIALPVWMVL TVPQRSANAL WASLRRSKLI       300
     SLCVVLGMAI ALSLLVVAVI GSRAAAEAAL PLIALPVLIV FALRLVADFV G                351
//

If you have problems or comments...

PBIL Back to PBIL home page