(data stored in ACNUC30630 zone)

EMBL: CU458896.PE362

CU458896.PE362       Location/Qualifiers
FT   CDS             362594..363481
FT                   /transl_table=11
FT                   /locus_tag="MAB_0366"
FT                   /product="Conserved hypothetical protein (hydride
FT                   transferase/luciferase?)"
FT                   /note="Similar to Q73ZV2_MYCPA 8e-51"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60465"
FT                   /db_xref="GOA:B1MFR5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFR5"
FT                   /protein_id="CAM60465.1"
FT                   /translation="MKIGVVAPVELGVTAEPDKILEFARAAERLGFSEISVVEHAVVIG
FT                   DTQSTYPYSPTGQSHLPDDIDIPDPLELLSFVAAATTTLGLSTGVLVLPDHHPVVLAKR
FT                   LATLDRLSRGRLRICAGVGWMREEIEACGGDFDRRGRAADEAIAVMRALWSTDGPTSHD
FT                   GEFYSFRNAYSYPKPVRPQGVPLYIGGHSKAAARRAGRLGSGFQPLGLVGDDLTAAVGV
FT                   MRAAAVDAGRDPRGLDLVLGHGLHRVDQAALDQAAHAGAGRMLLSASRRATTLEAVLEE
FT                   MAGCATRLELGGPR"
     MKIGVVAPVE LGVTAEPDKI LEFARAAERL GFSEISVVEH AVVIGDTQST YPYSPTGQSH        60
     LPDDIDIPDP LELLSFVAAA TTTLGLSTGV LVLPDHHPVV LAKRLATLDR LSRGRLRICA       120
     GVGWMREEIE ACGGDFDRRG RAADEAIAVM RALWSTDGPT SHDGEFYSFR NAYSYPKPVR       180
     PQGVPLYIGG HSKAAARRAG RLGSGFQPLG LVGDDLTAAV GVMRAAAVDA GRDPRGLDLV       240
     LGHGLHRVDQ AALDQAAHAG AGRMLLSASR RATTLEAVLE EMAGCATRLE LGGPR            295
//

If you have problems or comments...

PBIL Back to PBIL home page