(data stored in ACNUC30630 zone)

EMBL: CU458896.PE366

CU458896.PE366       Location/Qualifiers
FT   CDS             366012..367295
FT                   /transl_table=11
FT                   /locus_tag="MAB_0370"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q26ZX9_MYCFV e-200"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60469"
FT                   /db_xref="GOA:B1MFR9"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR032890"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFR9"
FT                   /protein_id="CAM60469.1"
FT                   /translation="MSRDELARDLEAARMRTLTITDHDDAELHRQYDPLMSPLVWDLAH
FT                   IGQQEELWLLRGGDPRRPGMLPGEIESLYDAFRHTRASRVQLPLLSPAQARAFCHEVRG
FT                   RVLDRLEALPSDGSARAEEFVYAMVLSHEHQHDETMMQALSIRHGAALLEAVDPVPPGR
FT                   PGVAGTSVLVPEGPFVLGVDAVDEPFSLDNERPAHVVHLRGFRIGTVPVTNAEWLAFMA
FT                   DGGYRRQELWTEIGWAHRCAEALTAPKFWNQGGTLTRFGRELQIVPDEPVQHVTFHEAQ
FT                   AYASWAGARLPTEAEWEKACVWDPEIGARRRFPWGAEAPARDRANLGGGALGPAPVGAY
FT                   PESASAYGAEQMLGDVWEWTTSPLRPWPGFTPMIYQQYSEPFFDGDYRVLRGGSWAVAR
FT                   EIMRPSFRNWDHPVRRQIFSGLRLAWDI"
     MSRDELARDL EAARMRTLTI TDHDDAELHR QYDPLMSPLV WDLAHIGQQE ELWLLRGGDP        60
     RRPGMLPGEI ESLYDAFRHT RASRVQLPLL SPAQARAFCH EVRGRVLDRL EALPSDGSAR       120
     AEEFVYAMVL SHEHQHDETM MQALSIRHGA ALLEAVDPVP PGRPGVAGTS VLVPEGPFVL       180
     GVDAVDEPFS LDNERPAHVV HLRGFRIGTV PVTNAEWLAF MADGGYRRQE LWTEIGWAHR       240
     CAEALTAPKF WNQGGTLTRF GRELQIVPDE PVQHVTFHEA QAYASWAGAR LPTEAEWEKA       300
     CVWDPEIGAR RRFPWGAEAP ARDRANLGGG ALGPAPVGAY PESASAYGAE QMLGDVWEWT       360
     TSPLRPWPGF TPMIYQQYSE PFFDGDYRVL RGGSWAVARE IMRPSFRNWD HPVRRQIFSG       420
     LRLAWDI                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page