(data stored in ACNUC30630 zone)

EMBL: CU458896.PE370

CU458896.PE370       Location/Qualifiers
FT   CDS             complement(370074..371549)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0374c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to O69666_MYCTU 0.0"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0374c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60473"
FT                   /db_xref="GOA:B1MFS3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR016602"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFS3"
FT                   /protein_id="CAM60473.1"
FT                   /translation="MGDEVARTQFTGEHRRAYRTKVQNCLDVFETMLAESRFDFERPLT
FT                   GLEIEFNLVDGNYQPAMTNTEVLASIADPAFQTELGAYNIEMNVPPRALPGSAALELEE
FT                   DVRASLNAAEQRAGERGAHIVMIGILPTVMPENLDGAWMSPSSRYRALNDAVFSARGED
FT                   MQIDIAGTERLSVRSPSIAPESACTSIQLHLQVAPDDFAANWNAAQALAGPQLALAANS
FT                   PFFFGKSLWAETRIELFTQSTDTRPQELKVQGVRPRVWFGERWITSIFDLFEENVLYFP
FT                   SLLPEISDEDPVAELAAGRAPRLQELRLHNGTVYRWNRPIYDVVNGTPHLRVENRVLPA
FT                   GPSVIDVMANAAFYYGALRSLSEDDRPVWTKMTFSAAHDNFLSGARHGTSAKLYWPGVG
FT                   EITADELTLRYLLPMAHEGLRRWGVAPQVRDRYLGVIEARAKSGINGAAWQTRTVSALE
FT                   RRGLNRKQALTEMLRKYCAHMHSNEPVHTWELI"
     MGDEVARTQF TGEHRRAYRT KVQNCLDVFE TMLAESRFDF ERPLTGLEIE FNLVDGNYQP        60
     AMTNTEVLAS IADPAFQTEL GAYNIEMNVP PRALPGSAAL ELEEDVRASL NAAEQRAGER       120
     GAHIVMIGIL PTVMPENLDG AWMSPSSRYR ALNDAVFSAR GEDMQIDIAG TERLSVRSPS       180
     IAPESACTSI QLHLQVAPDD FAANWNAAQA LAGPQLALAA NSPFFFGKSL WAETRIELFT       240
     QSTDTRPQEL KVQGVRPRVW FGERWITSIF DLFEENVLYF PSLLPEISDE DPVAELAAGR       300
     APRLQELRLH NGTVYRWNRP IYDVVNGTPH LRVENRVLPA GPSVIDVMAN AAFYYGALRS       360
     LSEDDRPVWT KMTFSAAHDN FLSGARHGTS AKLYWPGVGE ITADELTLRY LLPMAHEGLR       420
     RWGVAPQVRD RYLGVIEARA KSGINGAAWQ TRTVSALERR GLNRKQALTE MLRKYCAHMH       480
     SNEPVHTWEL I                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page