(data stored in ACNUC30630 zone)

EMBL: CU458896.PE375

CU458896.PE375       Location/Qualifiers
FT   CDS             375291..376142
FT                   /transl_table=11
FT                   /locus_tag="MAB_0379"
FT                   /product="Conserved hypothetical protein (MaoC-like
FT                   dehydratase?)"
FT                   /note="Similar to Q25UW2_MYCVN 7e-86"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60478"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFS8"
FT                   /protein_id="CAM60478.1"
FT                   /translation="MADTQYPFNNDGLDQWGAEETIEVDKDRLIAYAEATNDPIEEHRK
FT                   GQVAAPVFAIVPIFQSLVGTTMSVVPYQLIPRVVHGEQFFKFHRPIKPGDTLVAKSKMT
FT                   GYEGMENGTRGTVYAETRDAAGDLVNEQYVTFFFRKYDVGETRGELGPTFVLDEAVKVN
FT                   SPTASLTQHVDDDQTFRYGPAAGDPMPIHLDNDAAVAAGLPGIIAHGLCTMAFTSWAAL
FT                   TELADSRTERLKELAVRFAKPVLPGQDITTNFWTNGAAGTFSYETNVGEDLVIKNGHAV
FT                   IA"
     MADTQYPFNN DGLDQWGAEE TIEVDKDRLI AYAEATNDPI EEHRKGQVAA PVFAIVPIFQ        60
     SLVGTTMSVV PYQLIPRVVH GEQFFKFHRP IKPGDTLVAK SKMTGYEGME NGTRGTVYAE       120
     TRDAAGDLVN EQYVTFFFRK YDVGETRGEL GPTFVLDEAV KVNSPTASLT QHVDDDQTFR       180
     YGPAAGDPMP IHLDNDAAVA AGLPGIIAHG LCTMAFTSWA ALTELADSRT ERLKELAVRF       240
     AKPVLPGQDI TTNFWTNGAA GTFSYETNVG EDLVIKNGHA VIA                         283
//

If you have problems or comments...

PBIL Back to PBIL home page