(data stored in ACNUC30630 zone)

EMBL: CU458896.PE377

CU458896.PE377       Location/Qualifiers
FT   CDS             377163..377966
FT                   /transl_table=11
FT                   /locus_tag="MAB_0381"
FT                   /product="Glycerol uptake facilitator protein (GlpF)"
FT                   /note="Similar to Q826J3_STRAW 2e-82"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60480"
FT                   /db_xref="GOA:B1MFT0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFT0"
FT                   /protein_id="CAM60480.1"
FT                   /translation="MGQLAAEFVGTLILILFGVGVVAQVVTAGDEDYGNHNSIAWAWGM
FT                   GVTFGIFAAGRISGAHLNPAVTVALAVFRGFPWKQVIPFILAQVGGAFVAALLVRWNYG
FT                   SVLAAIDPGHTIATQGVFSTLPGNGALDVSLWGGLRDQIMGTAILLFLIFAITDRRNIR
FT                   MPEIFAALSIGAVVVGLGMAWGSIAGYAINPARDFGPRLASYLTGFDTAFLDQHGAQYW
FT                   WVPIVGPFIGGLVGAALYRYLVEPFLPADDPVTQSPSHTEEFANG"
     MGQLAAEFVG TLILILFGVG VVAQVVTAGD EDYGNHNSIA WAWGMGVTFG IFAAGRISGA        60
     HLNPAVTVAL AVFRGFPWKQ VIPFILAQVG GAFVAALLVR WNYGSVLAAI DPGHTIATQG       120
     VFSTLPGNGA LDVSLWGGLR DQIMGTAILL FLIFAITDRR NIRMPEIFAA LSIGAVVVGL       180
     GMAWGSIAGY AINPARDFGP RLASYLTGFD TAFLDQHGAQ YWWVPIVGPF IGGLVGAALY       240
     RYLVEPFLPA DDPVTQSPSH TEEFANG                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page