(data stored in ACNUC30630 zone)

EMBL: CU458896.PE385

CU458896.PE385       Location/Qualifiers
FT   CDS             complement(385153..386127)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0389c"
FT                   /product="Putative regulatory protein"
FT                   /note="Similar to Q265Z2_MYCVN e-133"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0389c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60488"
FT                   /db_xref="GOA:B1MFT8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFT8"
FT                   /protein_id="CAM60488.1"
FT                   /translation="MTQATTTGSSGETARNALAALREQIAIVVVGQDSVVSGLVVALLC
FT                   RGHVLLEGVPGVAKTLLVRTLSAALSLDFKRVQFTPDLMPGDVTGSLVYDARTAAFEFR
FT                   AGPVFTNLLLADEINRTPPKTQAALLEAMEERQVTVDGTPRPLPDPFIVAATQNPIEYE
FT                   GTYQLPEAQLDRFLMKLNVSLPERDQEIAILDRHAHGFDPRNLSHVTPVASAADLAAGR
FT                   AAVGQVLVAPEVLAYVVDVIRATRQSPSLQLGASPRAATALLATSRAWAWLSGRNYVTP
FT                   DDVKAMARPTLRHRIGLRPEAELEGATSDRVLDGILVTVPVPR"
     MTQATTTGSS GETARNALAA LREQIAIVVV GQDSVVSGLV VALLCRGHVL LEGVPGVAKT        60
     LLVRTLSAAL SLDFKRVQFT PDLMPGDVTG SLVYDARTAA FEFRAGPVFT NLLLADEINR       120
     TPPKTQAALL EAMEERQVTV DGTPRPLPDP FIVAATQNPI EYEGTYQLPE AQLDRFLMKL       180
     NVSLPERDQE IAILDRHAHG FDPRNLSHVT PVASAADLAA GRAAVGQVLV APEVLAYVVD       240
     VIRATRQSPS LQLGASPRAA TALLATSRAW AWLSGRNYVT PDDVKAMARP TLRHRIGLRP       300
     EAELEGATSD RVLDGILVTV PVPR                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page