(data stored in ACNUC30630 zone)

EMBL: CU458896.PE388

CU458896.PE388       Location/Qualifiers
FT   CDS             complement(387904..389112)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0392c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q26YN4_MYCFV 4e-50"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0392c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60491"
FT                   /db_xref="GOA:B1MFU1"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFU1"
FT                   /protein_id="CAM60491.1"
FT                   /translation="MSNDEGGVTPSPLPPGPSPAYPPPAPGYPPAGTAGYPPPGFAYQP
FT                   PPPGYQNPSAVPYWVTPEPPALKPGVIPLRPLDLSSLYNGAIAAIRANPKTTLGLTAIV
FT                   VIVSQLLIFGIQAAPATAVLTGAASFDKNTEDSFGAAFGLGYIGGQLIGAVVTSLVTII
FT                   LSGMLTVTIGRSVFGERTTIKEAWQRAKPRIWALLGVAVVELVLFAVVLGFGVAVVVGL
FT                   ALTVGPAGAIPAGLLLALAYFLFYLYLIPVFSLVPSVLILEQQSVFGAIGRSVSLVRKG
FT                   FWRLLGILVLTGFIVGFVSMIIGMPFILVGEVAAFAGSDPNNLGPKMLLIFALAAVGAV
FT                   IAQIISLPFKAAVNVLLYTDQRMRTEALDLVLQTEARTRERLGQPGIDPDSLWLPMRPP
FT                   VQV"
     MSNDEGGVTP SPLPPGPSPA YPPPAPGYPP AGTAGYPPPG FAYQPPPPGY QNPSAVPYWV        60
     TPEPPALKPG VIPLRPLDLS SLYNGAIAAI RANPKTTLGL TAIVVIVSQL LIFGIQAAPA       120
     TAVLTGAASF DKNTEDSFGA AFGLGYIGGQ LIGAVVTSLV TIILSGMLTV TIGRSVFGER       180
     TTIKEAWQRA KPRIWALLGV AVVELVLFAV VLGFGVAVVV GLALTVGPAG AIPAGLLLAL       240
     AYFLFYLYLI PVFSLVPSVL ILEQQSVFGA IGRSVSLVRK GFWRLLGILV LTGFIVGFVS       300
     MIIGMPFILV GEVAAFAGSD PNNLGPKMLL IFALAAVGAV IAQIISLPFK AAVNVLLYTD       360
     QRMRTEALDL VLQTEARTRE RLGQPGIDPD SLWLPMRPPV QV                          402
//

If you have problems or comments...

PBIL Back to PBIL home page