(data stored in ACNUC30630 zone)

EMBL: CU458896.PE392

CU458896.PE392       Location/Qualifiers
FT   CDS             complement(392190..392798)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0396c"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0396c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60495"
FT                   /db_xref="GOA:B1MFU5"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFU5"
FT                   /protein_id="CAM60495.1"
FT                   /translation="MTQPQYPQGQFQQTQPQQFPTYQQPSPYGMPPGGYAPAPKPPRPP
FT                   LTPQQKALAIVGGSLGVFLIALLVLGLTTNNSSTESVRTHASDQIIDSPRSSGSNDEQD
FT                   IKAIKQTISGMAEAAKANDFKKMLTFFCAKYREAFKDIAGSGQAPDLNALTKSDNGPSK
FT                   ITGLDINGDTAVIHITDAKGKHDIEFKKETGGWKFCPRA"
     MTQPQYPQGQ FQQTQPQQFP TYQQPSPYGM PPGGYAPAPK PPRPPLTPQQ KALAIVGGSL        60
     GVFLIALLVL GLTTNNSSTE SVRTHASDQI IDSPRSSGSN DEQDIKAIKQ TISGMAEAAK       120
     ANDFKKMLTF FCAKYREAFK DIAGSGQAPD LNALTKSDNG PSKITGLDIN GDTAVIHITD       180
     AKGKHDIEFK KETGGWKFCP RA                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page