(data stored in ACNUC30630 zone)

EMBL: CU458896.PE393

CU458896.PE393       Location/Qualifiers
FT   CDS             complement(392881..393765)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0397c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q89W12_BRAJA 2e-34"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0397c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60496"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFU6"
FT                   /protein_id="CAM60496.1"
FT                   /translation="MDSEVERRLRQMVFDRLTEIVADRGAITREELESLEVDNQVRRVI
FT                   GRNRGIWNPSDLNATLSVVSNPKGPYTDTHVGDSLFSYDYEARSTDGANRKLRRAYELE
FT                   LPIILLRTIRAGVFVPVFPVYVVADDMANRRFILALDESLRSVSDPLHLSPVERAYAER
FT                   TTKLRLHQPEFRGRILLAYQQQCTVCTLRHGKLLDAAHIIGDHKPNGLPLVQNGLSLCK
FT                   LHHAAYDTNLLGISPDYAVHINRELMDEVDGPMLRHGLQEMDGRTLALPKRVTDRPSKD
FT                   RLAERFDEFCAAS"
     MDSEVERRLR QMVFDRLTEI VADRGAITRE ELESLEVDNQ VRRVIGRNRG IWNPSDLNAT        60
     LSVVSNPKGP YTDTHVGDSL FSYDYEARST DGANRKLRRA YELELPIILL RTIRAGVFVP       120
     VFPVYVVADD MANRRFILAL DESLRSVSDP LHLSPVERAY AERTTKLRLH QPEFRGRILL       180
     AYQQQCTVCT LRHGKLLDAA HIIGDHKPNG LPLVQNGLSL CKLHHAAYDT NLLGISPDYA       240
     VHINRELMDE VDGPMLRHGL QEMDGRTLAL PKRVTDRPSK DRLAERFDEF CAAS             294
//

If you have problems or comments...

PBIL Back to PBIL home page