(data stored in ACNUC30630 zone)

EMBL: CU458896.PE403

CU458896.PE403       Location/Qualifiers
FT   CDS             complement(407836..408798)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0407c"
FT                   /product="Conserved hypothetical protein (metallophospho
FT                   esterase?)"
FT                   /note="Similar to Q265Y0_MYCVN e-132"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0407c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60506"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFV6"
FT                   /protein_id="CAM60506.1"
FT                   /translation="MSTSLNTVIKRAAAYSAGSAALGIGYASIIERNAFTVREATMDVL
FT                   DPGASPLRVLHISDIHMRPGQRLKQAWLRELAQWQPDLVINTGDNLAHPKAVSSVVQSL
FT                   GDLLSIPGLFVFGSNDYFGPRLKNPAKYLYKSHERKHGEPLPWQDLRAAFTERGWHDMT
FT                   HTRREIEVGGVRIAAAGVDDPHLHRDRYDTIAGMPNPLATLRLGLTHSPEPRVLDRFAE
FT                   DGYQLVMAGHTHGGQLCLPLYGAIVTNCELDRSRVKGPSQWGSHMQLHVSAGIGTSPFA
FT                   PMRFFCRPEATLLTLVPARTSGHGADAESGDRSPSATVQ"
     MSTSLNTVIK RAAAYSAGSA ALGIGYASII ERNAFTVREA TMDVLDPGAS PLRVLHISDI        60
     HMRPGQRLKQ AWLRELAQWQ PDLVINTGDN LAHPKAVSSV VQSLGDLLSI PGLFVFGSND       120
     YFGPRLKNPA KYLYKSHERK HGEPLPWQDL RAAFTERGWH DMTHTRREIE VGGVRIAAAG       180
     VDDPHLHRDR YDTIAGMPNP LATLRLGLTH SPEPRVLDRF AEDGYQLVMA GHTHGGQLCL       240
     PLYGAIVTNC ELDRSRVKGP SQWGSHMQLH VSAGIGTSPF APMRFFCRPE ATLLTLVPAR       300
     TSGHGADAES GDRSPSATVQ                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page