(data stored in ACNUC30630 zone)

EMBL: CU458896.PE413

CU458896.PE413       Location/Qualifiers
FT   CDS             complement(417276..417638)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0417c"
FT                   /product="Conserved hypothetical membrane protein"
FT                   /note="Similar to O69643_MYCTU 8e-11"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0417c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60516"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFW6"
FT                   /protein_id="CAM60516.1"
FT                   /translation="MLASLGLGKLEAGLMRHTLQPSEVADFLDQASPSDMNRLARDGMP
FT                   SAIEGLHRRQLQRIEPSLEAVYQATTNSYNHPTSRTGTSTARSRGNGPSLREESISSMR
FT                   SRHSVVDSLRAGGAAV"
     MLASLGLGKL EAGLMRHTLQ PSEVADFLDQ ASPSDMNRLA RDGMPSAIEG LHRRQLQRIE        60
     PSLEAVYQAT TNSYNHPTSR TGTSTARSRG NGPSLREESI SSMRSRHSVV DSLRAGGAAV       120
//

If you have problems or comments...

PBIL Back to PBIL home page