(data stored in ACNUC30630 zone)

EMBL: CU458896.PE419

CU458896.PE419       Location/Qualifiers
FT   CDS             complement(422256..422777)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0423c"
FT                   /product="Conserved hypothetical membrane protein"
FT                   /note="Similar to Q744D6_MYCPA 1e-37"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0423c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60522"
FT                   /db_xref="GOA:B1MFX2"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFX2"
FT                   /protein_id="CAM60522.1"
FT                   /translation="MSSPGSRNYRTDSNGVPITVAAIPLSDPNATGTGEPTIGNLVRDA
FT                   TTQVSALVRAEVELARAEVIRDVKKGVAGSIFFIAALVVLFYSTFFFFFFAAEVLKIWL
FT                   PAWAAYLIIFAAMVFVAVLAVLIGYLQVRRIRGPQATIESVKETANVFSREDEAPSDTK
FT                   AIKPVDPSGW"
     MSSPGSRNYR TDSNGVPITV AAIPLSDPNA TGTGEPTIGN LVRDATTQVS ALVRAEVELA        60
     RAEVIRDVKK GVAGSIFFIA ALVVLFYSTF FFFFFAAEVL KIWLPAWAAY LIIFAAMVFV       120
     AVLAVLIGYL QVRRIRGPQA TIESVKETAN VFSREDEAPS DTKAIKPVDP SGW              173
//

If you have problems or comments...

PBIL Back to PBIL home page