(data stored in ACNUC30630 zone)

EMBL: CU458896.PE425

CU458896.PE425       Location/Qualifiers
FT   CDS             429479..431128
FT                   /transl_table=11
FT                   /locus_tag="MAB_0429"
FT                   /product="Putative oligopeptide ABC transporter,ATP-binding
FT                   protein"
FT                   /note="Similar to Q6AFU2_LEIXX e-151"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60528"
FT                   /db_xref="GOA:B1MFX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFX8"
FT                   /protein_id="CAM60528.1"
FT                   /translation="MEVPTSDSVVDITGLTVDFEVDKQWVPAVKGVSLSVAKGEVLAIV
FT                   GESGSGKSTTAMAIPALLPPSARVRGSVKLNGAELLGATNDELRAVRGKDVAVIFQEPM
FT                   TALNPVYTIGWQIAEAVCAHKKMSRRQARDRAVELLDLVDMPEPAKRVKHYPHQLSGGQ
FT                   RQRAMIAQALALDPGLLIADEPTTALDVTVQAEILDLMRDLRHRIDAGIILITHDMGVV
FT                   ADMADRIMVMKDGEVVEQGDAEGIFHRAQQPYTRQLLASVPHLGATLHGRDESNPPPTD
FT                   LALSVEHAVIEYPGKSGSFRAVDDVSFTIGRGEVVGLVGESGSGKSTIGRAAVGLLRVA
FT                   SGTICVAGQDISTANRKQLRDIRSKVGVVFQDPGSSLNPRWPIGQSIAEPLTLHTDMDR
FT                   TQREGRVKTLLEQVQLPAAMRNRFPHQLSGGQRQRVGIARALALEPTLLIADEPTSALD
FT                   VSVQATVLDLFAELQREHGFACLFISHDLAVVELVASRIAVLNRGRLAEFGSDTQVLTA
FT                   PKDDYTKRLLAAVPVPDPEQQRIRREERQALR"
     MEVPTSDSVV DITGLTVDFE VDKQWVPAVK GVSLSVAKGE VLAIVGESGS GKSTTAMAIP        60
     ALLPPSARVR GSVKLNGAEL LGATNDELRA VRGKDVAVIF QEPMTALNPV YTIGWQIAEA       120
     VCAHKKMSRR QARDRAVELL DLVDMPEPAK RVKHYPHQLS GGQRQRAMIA QALALDPGLL       180
     IADEPTTALD VTVQAEILDL MRDLRHRIDA GIILITHDMG VVADMADRIM VMKDGEVVEQ       240
     GDAEGIFHRA QQPYTRQLLA SVPHLGATLH GRDESNPPPT DLALSVEHAV IEYPGKSGSF       300
     RAVDDVSFTI GRGEVVGLVG ESGSGKSTIG RAAVGLLRVA SGTICVAGQD ISTANRKQLR       360
     DIRSKVGVVF QDPGSSLNPR WPIGQSIAEP LTLHTDMDRT QREGRVKTLL EQVQLPAAMR       420
     NRFPHQLSGG QRQRVGIARA LALEPTLLIA DEPTSALDVS VQATVLDLFA ELQREHGFAC       480
     LFISHDLAVV ELVASRIAVL NRGRLAEFGS DTQVLTAPKD DYTKRLLAAV PVPDPEQQRI       540
     RREERQALR                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page