(data stored in ACNUC30630 zone)

EMBL: CU458896.PE428

CU458896.PE428       Location/Qualifiers
FT   CDS             433577..434650
FT                   /transl_table=11
FT                   /locus_tag="MAB_0432"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q26YS7_MYCFV 4e-63"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60531"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGJ7"
FT                   /protein_id="CAM60531.1"
FT                   /translation="MEANTGQPIVVAVGDRQLSNEIERIVAAAGKPLVLATDAGSISRQ
FT                   AWTRAGAVVLDGADTSMAALAQLPRRSRVLLICRDEPTNEVWRRAVEVGAEQVLALPED
FT                   EATLVAALSAMPSTASAGRAPVIVVVGGCGGAGASVLCAAIGLRAPSGAMIVDADPYGG
FT                   GMDLLLGWEDIPGLRWPDVDMRGGRVSFDALRRALPHRRGLVVLSGDRTGGGGNVETIA
FT                   GVIDSAREAGVAVVVDLPRRLGASGVAALERADLVVVVTTAEVRACAASALVARAVRTT
FT                   NPNVGVVVRGPAPSGLRAPEVAEIVGVPLIAAMRPEPNLASRLDKGGLRLSRRSPLAAA
FT                   AQSVLSLVSQDGKASAA"
     MEANTGQPIV VAVGDRQLSN EIERIVAAAG KPLVLATDAG SISRQAWTRA GAVVLDGADT        60
     SMAALAQLPR RSRVLLICRD EPTNEVWRRA VEVGAEQVLA LPEDEATLVA ALSAMPSTAS       120
     AGRAPVIVVV GGCGGAGASV LCAAIGLRAP SGAMIVDADP YGGGMDLLLG WEDIPGLRWP       180
     DVDMRGGRVS FDALRRALPH RRGLVVLSGD RTGGGGNVET IAGVIDSARE AGVAVVVDLP       240
     RRLGASGVAA LERADLVVVV TTAEVRACAA SALVARAVRT TNPNVGVVVR GPAPSGLRAP       300
     EVAEIVGVPL IAAMRPEPNL ASRLDKGGLR LSRRSPLAAA AQSVLSLVSQ DGKASAA          357
//

If you have problems or comments...

PBIL Back to PBIL home page