(data stored in ACNUC30630 zone)

EMBL: CU458896.PE43

CU458896.PE43        Location/Qualifiers
FT   CDS             43895..44203
FT                   /transl_table=11
FT                   /locus_tag="MAB_0046"
FT                   /product="Probable PE family protein"
FT                   /note="Similar to Q273L0_MYCFV 2e-17"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60146"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAP1"
FT                   /protein_id="CAM60146.1"
FT                   /translation="MNLNVVPEGLTATSAAVEALTARLAAAHAAAAPVIGAVVPPAADP
FT                   VSLETAAGFSARGIEHSGVAAQAVEELGRAGLGVSESAASYTTGDMQAAAAYMIARG"
     MNLNVVPEGL TATSAAVEAL TARLAAAHAA AAPVIGAVVP PAADPVSLET AAGFSARGIE        60
     HSGVAAQAVE ELGRAGLGVS ESAASYTTGD MQAAAAYMIA RG                          102
//

If you have problems or comments...

PBIL Back to PBIL home page