(data stored in ACNUC30630 zone)

EMBL: CU458896.PE436

CU458896.PE436       Location/Qualifiers
FT   CDS             440972..441691
FT                   /transl_table=11
FT                   /locus_tag="MAB_0440"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q265V9_MYCVN 2e-65"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60539"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGK5"
FT                   /protein_id="CAM60539.1"
FT                   /translation="MLQELVERLVAQHRVALALLHGEIQVAFEEAAAALAARFPDLRQV
FT                   HGGVFSGHLRAVLLAMNGVDRLTRRGESTRKVPEGASCGPQSTLRMSMGLNSSVRLGDP
FT                   SMMWTRVRKLTPQIVETLASLTPQPMPAPKAGAQMTLDAGQQDRVFGPEGIGEQYELVL
FT                   YWWPRADLSGVENAILAAVADLGVSGEERILAFAPLPAAVRPERVSDVDTGEDYEPAGD
FT                   YEQFLPKKSSDTGDPGA"
     MLQELVERLV AQHRVALALL HGEIQVAFEE AAAALAARFP DLRQVHGGVF SGHLRAVLLA        60
     MNGVDRLTRR GESTRKVPEG ASCGPQSTLR MSMGLNSSVR LGDPSMMWTR VRKLTPQIVE       120
     TLASLTPQPM PAPKAGAQMT LDAGQQDRVF GPEGIGEQYE LVLYWWPRAD LSGVENAILA       180
     AVADLGVSGE ERILAFAPLP AAVRPERVSD VDTGEDYEPA GDYEQFLPKK SSDTGDPGA        239
//

If you have problems or comments...

PBIL Back to PBIL home page