(data stored in ACNUC30630 zone)

EMBL: CU458896.PE44

CU458896.PE44        Location/Qualifiers
FT   CDS             44209..45741
FT                   /transl_table=11
FT                   /locus_tag="MAB_0047"
FT                   /product="Probable PPE family protein"
FT                   /note="Similar to Q73TD6_MYCPA 2e-63"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60147"
FT                   /db_xref="GOA:B1ME83"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME83"
FT                   /protein_id="CAM60147.1"
FT                   /translation="MSAPIWMASPPEVHSALLSAGPGPGALLAAAAQWQALSTQYATAA
FT                   TELTELLGSTVAGSWQGPSAMQYAASHAPYLAWLTQQSAMSATNAVLHETSAAAYTTAL
FT                   AAMPTLAELAANHMIHGVLLATNFFGINTIPIALNEADYIRMWIQAATTMGVYQGVSSA
FT                   ALAATTPTQPSPMIMAPGGEMSRMSADMMSMAAQPQAAESGSALDSSNNIMDQLMRFMT
FT                   NPLGTLQDMIEDFMRNPVAAFFAWFPLLFFIAYEAFFIPFGFTFWGVLLSAPAWLPIVL
FT                   GLALSALVPPAGIEEPGQEDEPGREPTRIERRSPQQDLQLAHVPSGSPTPGGSTTTTVT
FT                   SGGSAPPAPAPATATPAYMVYAVQEDPPAARFGPTLNEGSGAKAPAAGISAAAAAAASA
FT                   RSRARRKRAARIKDPAPQFMDMNSSVAPDFSESAARQTTGVGASARGAGRLGFAGTAPA
FT                   AAGTTAAAGLVERDSGTAEALDGARTVPMLPTSWGTDSEHGPDRPAEGGSST"
     MSAPIWMASP PEVHSALLSA GPGPGALLAA AAQWQALSTQ YATAATELTE LLGSTVAGSW        60
     QGPSAMQYAA SHAPYLAWLT QQSAMSATNA VLHETSAAAY TTALAAMPTL AELAANHMIH       120
     GVLLATNFFG INTIPIALNE ADYIRMWIQA ATTMGVYQGV SSAALAATTP TQPSPMIMAP       180
     GGEMSRMSAD MMSMAAQPQA AESGSALDSS NNIMDQLMRF MTNPLGTLQD MIEDFMRNPV       240
     AAFFAWFPLL FFIAYEAFFI PFGFTFWGVL LSAPAWLPIV LGLALSALVP PAGIEEPGQE       300
     DEPGREPTRI ERRSPQQDLQ LAHVPSGSPT PGGSTTTTVT SGGSAPPAPA PATATPAYMV       360
     YAVQEDPPAA RFGPTLNEGS GAKAPAAGIS AAAAAAASAR SRARRKRAAR IKDPAPQFMD       420
     MNSSVAPDFS ESAARQTTGV GASARGAGRL GFAGTAPAAA GTTAAAGLVE RDSGTAEALD       480
     GARTVPMLPT SWGTDSEHGP DRPAEGGSST                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page