(data stored in ACNUC30630 zone)

EMBL: CU458896.PE441

CU458896.PE441       Location/Qualifiers
FT   CDS             447133..448278
FT                   /transl_table=11
FT                   /locus_tag="MAB_0445"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q3GZC9_9ACTO 2e-24"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60544"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGL0"
FT                   /protein_id="CAM60544.1"
FT                   /translation="MAKGTSAGLLDEARSQSVFKHAILQSYLPRFAAMTGKWAQGNRVV
FT                   LLDGFAGRGRYPDGKPASGEQMLLAARKIQRTTHVEVMLVEREHKDFLTLSDVAAEYSR
FT                   LGITAEAFHGEVENYLDEVVHRATGVPLFLFLDPCGANVQYEAITKTLSQDRRLRRPAT
FT                   EALMNISADLIRRAAGCVSKGQLHNGSITKLDNMCGGRWWQPIALAAYEQNPKRTWEAA
FT                   ADAVVNQHAQRLAEQSGMRPVVVPVRRKIHHQPVYYLVFLTRAPHGRWIFGDALAHARQ
FT                   QWLRVLGPDDEEAEGMLFNFVEDQIESESQRAYAQLKENITALADRGRAKLVDHPEAVF
FT                   GSAFGLAQEKQVRQAVRELNKANEVQLDDTAPQPRDWIIWR"
     MAKGTSAGLL DEARSQSVFK HAILQSYLPR FAAMTGKWAQ GNRVVLLDGF AGRGRYPDGK        60
     PASGEQMLLA ARKIQRTTHV EVMLVEREHK DFLTLSDVAA EYSRLGITAE AFHGEVENYL       120
     DEVVHRATGV PLFLFLDPCG ANVQYEAITK TLSQDRRLRR PATEALMNIS ADLIRRAAGC       180
     VSKGQLHNGS ITKLDNMCGG RWWQPIALAA YEQNPKRTWE AAADAVVNQH AQRLAEQSGM       240
     RPVVVPVRRK IHHQPVYYLV FLTRAPHGRW IFGDALAHAR QQWLRVLGPD DEEAEGMLFN       300
     FVEDQIESES QRAYAQLKEN ITALADRGRA KLVDHPEAVF GSAFGLAQEK QVRQAVRELN       360
     KANEVQLDDT APQPRDWIIW R                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page