(data stored in ACNUC30630 zone)

EMBL: CU458896.PE453

CU458896.PE453       Location/Qualifiers
FT   CDS             458467..458868
FT                   /transl_table=11
FT                   /locus_tag="MAB_0457"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60556"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGM2"
FT                   /protein_id="CAM60556.1"
FT                   /translation="MTPALRASTIGPMATALSAPPRTSRRSLKAPPRHLAVGALSAAVS
FT                   AVMLAAPAAAGPGEPGPQAPGNAQIIITELKTRGDQVIINGDTTGKPLAKCTATAVRVG
FT                   RHIYNQVPQRKGPPTRTLAAHVMYVTVQC"
     MTPALRASTI GPMATALSAP PRTSRRSLKA PPRHLAVGAL SAAVSAVMLA APAAAGPGEP        60
     GPQAPGNAQI IITELKTRGD QVIINGDTTG KPLAKCTATA VRVGRHIYNQ VPQRKGPPTR       120
     TLAAHVMYVT VQC                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page