(data stored in ACNUC30630 zone)

EMBL: CU458896.PE456

CU458896.PE456       Location/Qualifiers
FT   CDS             460694..461134
FT                   /transl_table=11
FT                   /locus_tag="MAB_0460"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60559"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGM5"
FT                   /protein_id="CAM60559.1"
FT                   /translation="MRMRPVRGYRRRRQRGAAALVLVAAVAVVAALGCLTGAPRSWSTA
FT                   GPGGTAHVARGPVSEMALPFLRAAADPVGADLHAPCPHAQLSATTRAGGNMPLMGAVPM
FT                   VLGALAAADAEAGALVRGPPPRARVAAAGGPMSLHQLCVIRR"
     MRMRPVRGYR RRRQRGAAAL VLVAAVAVVA ALGCLTGAPR SWSTAGPGGT AHVARGPVSE        60
     MALPFLRAAA DPVGADLHAP CPHAQLSATT RAGGNMPLMG AVPMVLGALA AADAEAGALV       120
     RGPPPRARVA AAGGPMSLHQ LCVIRR                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page