(data stored in ACNUC30630 zone)

EMBL: CU458896.PE469

CU458896.PE469       Location/Qualifiers
FT   CDS             470283..470489
FT                   /transl_table=11
FT                   /locus_tag="MAB_0473"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q744C2_MYCPA 9e-09"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60572"
FT                   /db_xref="GOA:B1MGN8"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGN8"
FT                   /protein_id="CAM60572.1"
FT                   /translation="MIHNGMLTKVRRRLVVVVESEDGMSTVEYAIGTIAAAAFGAILYT
FT                   VVTGDSIVSALTNIIARALNTSV"
     MIHNGMLTKV RRRLVVVVES EDGMSTVEYA IGTIAAAAFG AILYTVVTGD SIVSALTNII        60
     ARALNTSV                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page