(data stored in ACNUC30630 zone)

EMBL: CU458896.PE475

CU458896.PE475       Location/Qualifiers
FT   CDS             475516..475956
FT                   /transl_table=11
FT                   /locus_tag="MAB_0479"
FT                   /product="Putative regulatory protein, MarR"
FT                   /note="Similar to Q43WJ6_SOLUS 6e-18"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60578"
FT                   /db_xref="GOA:B1MGP4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGP4"
FT                   /protein_id="CAM60578.1"
FT                   /translation="MVTDAVDEIVSNCLAVRVRLLGRAITSVYDHALEGHGVSIAQINL
FT                   MAALGRIGPCSPARIGEVLQLERSTVSRNVGLLIRRGWVEAVASDAKGVREVALTSSGG
FT                   EKIETVMPEWRRAQEEAALILGSGGIKSVRTLAANFGLPSGD"
     MVTDAVDEIV SNCLAVRVRL LGRAITSVYD HALEGHGVSI AQINLMAALG RIGPCSPARI        60
     GEVLQLERST VSRNVGLLIR RGWVEAVASD AKGVREVALT SSGGEKIETV MPEWRRAQEE       120
     AALILGSGGI KSVRTLAANF GLPSGD                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page