(data stored in ACNUC30630 zone)

EMBL: CU458896.PE478

CU458896.PE478       Location/Qualifiers
FT   CDS             complement(477496..478416)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0482c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to A1IEG0_9DELT 7e-43"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0482c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60581"
FT                   /db_xref="GOA:B1MGP7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGP7"
FT                   /protein_id="CAM60581.1"
FT                   /translation="MVLAAAIQLEAVIGDVAANLGKCAQLAAEAGRAGAKIIALPEFFT
FT                   TGIAFDPALRDAALPPEGAATELLRTLAHHYDALVGGSFLCRDKDGHVRNAYFAADATG
FT                   MVGRHDKDLPTMWENAFYIGGQDDGVFRAGTLNVGAAVCWELMRTRTARRMRAHVDLVM
FT                   AGSGWWSIPPWRPRATFAAMERRNHQTARAAAATFAKYVGAPVVHAAHVGEFHCAMPWI
FT                   PLKYRGHFEGSTLITDGTGSIVAERRPEEGPGIVLGDIHLGRLPPAAEVPDRFWLHSRG
FT                   ALPTAAWHYQRWHGRRWYRRNMVTT"
     MVLAAAIQLE AVIGDVAANL GKCAQLAAEA GRAGAKIIAL PEFFTTGIAF DPALRDAALP        60
     PEGAATELLR TLAHHYDALV GGSFLCRDKD GHVRNAYFAA DATGMVGRHD KDLPTMWENA       120
     FYIGGQDDGV FRAGTLNVGA AVCWELMRTR TARRMRAHVD LVMAGSGWWS IPPWRPRATF       180
     AAMERRNHQT ARAAAATFAK YVGAPVVHAA HVGEFHCAMP WIPLKYRGHF EGSTLITDGT       240
     GSIVAERRPE EGPGIVLGDI HLGRLPPAAE VPDRFWLHSR GALPTAAWHY QRWHGRRWYR       300
     RNMVTT                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page