(data stored in ACNUC30630 zone)

EMBL: CU458896.PE485

CU458896.PE485       Location/Qualifiers
FT   CDS             485179..487971
FT                   /transl_table=11
FT                   /locus_tag="MAB_0489"
FT                   /product="DNA topoisomerase I (Omega-protein)"
FT                   /note="Similar to TOP1_MYCBO 0.0"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60588"
FT                   /db_xref="GOA:B1MGQ4"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGQ4"
FT                   /protein_id="CAM60588.1"
FT                   /translation="MRRLVIVESPTKARKIAGYLGDGYVVESSRGHIRDLPRAAADVPA
FT                   KYKSEPWARLGVNVDADFEPLYIVSPDKKGTVTELKGLLKDVDELYLATDGDREGEAIA
FT                   WHLLETLKPKVPVRRMVFHEITEQAILAAAQDPRDLDNNLVDAQETRRILDRLYGYEVS
FT                   PVLWKKVGRNLSAGRVQSVATRIIVQRERDRMAFRSAGYWDLGAELDAGKDNPAAKPPR
FT                   FHARLVSVDALRVASGRDFDSLGQVKETSNGPGVLVLDETRANALVAGLSQATLTVVSA
FT                   EEKPYTRKPYPPFMTSTLQQEAGRKLRFSSERTMSIAQRLYENGYITYMRTDSTTLSDS
FT                   ALQAARSQAAELYGNEYVHPSPRQYTRKVKNAQEAHEAIRPAGETFKTPGQLHSSLDND
FT                   EFRLYELIWQRTVASQMADARGTTLSLRLAGTATSGEQVVFTASGRTITFPGFLSAYVE
FT                   TVDELSGGEADDEERRLPQLRQGQSVTVAELSADGHTTNPPARYTEASLIKALEELGIG
FT                   RPSTYSSIIRTIQDRGYVHKRGSALVPSWTAFAVIGLLEQHFGRLVDYDFTAAMEDDLD
FT                   EIASGNERRTNWLNAFYFGGDHGVEGSVARAGGLKRLVGVNLEEIDAREINSIKLFDDD
FT                   QGRPIYVRVGKNGPYLERMVADPDGEAGALIPQRANVKDGVTPDELTVEMAEQLFAIPQ
FT                   EGRTLGVDPETGHEIVAKDGRFGPYVTEVLPAPPEPVEAEKPKRGAKKVEGPKPRTGSL
FT                   LKSMTLETVTLEDALRLLSLPRVVGVDPASGEEITAQNGRYGPYLKRGTDSRSLATEGQ
FT                   IFTVTLDEALKIYSEPKRRGGQAASAAPLRELGVDSATGKPMVIKDGRFGPYVTDGETN
FT                   ASLRKGDDVLSITDERASELLADRRARGPVKRAKKAPAKAAKKAPAKKAPAKKAAKKAT
FT                   "
     MRRLVIVESP TKARKIAGYL GDGYVVESSR GHIRDLPRAA ADVPAKYKSE PWARLGVNVD        60
     ADFEPLYIVS PDKKGTVTEL KGLLKDVDEL YLATDGDREG EAIAWHLLET LKPKVPVRRM       120
     VFHEITEQAI LAAAQDPRDL DNNLVDAQET RRILDRLYGY EVSPVLWKKV GRNLSAGRVQ       180
     SVATRIIVQR ERDRMAFRSA GYWDLGAELD AGKDNPAAKP PRFHARLVSV DALRVASGRD       240
     FDSLGQVKET SNGPGVLVLD ETRANALVAG LSQATLTVVS AEEKPYTRKP YPPFMTSTLQ       300
     QEAGRKLRFS SERTMSIAQR LYENGYITYM RTDSTTLSDS ALQAARSQAA ELYGNEYVHP       360
     SPRQYTRKVK NAQEAHEAIR PAGETFKTPG QLHSSLDNDE FRLYELIWQR TVASQMADAR       420
     GTTLSLRLAG TATSGEQVVF TASGRTITFP GFLSAYVETV DELSGGEADD EERRLPQLRQ       480
     GQSVTVAELS ADGHTTNPPA RYTEASLIKA LEELGIGRPS TYSSIIRTIQ DRGYVHKRGS       540
     ALVPSWTAFA VIGLLEQHFG RLVDYDFTAA MEDDLDEIAS GNERRTNWLN AFYFGGDHGV       600
     EGSVARAGGL KRLVGVNLEE IDAREINSIK LFDDDQGRPI YVRVGKNGPY LERMVADPDG       660
     EAGALIPQRA NVKDGVTPDE LTVEMAEQLF AIPQEGRTLG VDPETGHEIV AKDGRFGPYV       720
     TEVLPAPPEP VEAEKPKRGA KKVEGPKPRT GSLLKSMTLE TVTLEDALRL LSLPRVVGVD       780
     PASGEEITAQ NGRYGPYLKR GTDSRSLATE GQIFTVTLDE ALKIYSEPKR RGGQAASAAP       840
     LRELGVDSAT GKPMVIKDGR FGPYVTDGET NASLRKGDDV LSITDERASE LLADRRARGP       900
     VKRAKKAPAK AAKKAPAKKA PAKKAAKKAT                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page