(data stored in ACNUC30630 zone)

EMBL: CU458896.PE488

CU458896.PE488       Location/Qualifiers
FT   CDS             491095..491610
FT                   /transl_table=11
FT                   /locus_tag="MAB_0492"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q274X1_MYCFV 3e-17"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60591"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGQ7"
FT                   /protein_id="CAM60591.1"
FT                   /translation="MWFARRDASGHGAVVAAVDQVLTISGQGSVVEVARNWAQANGRVM
FT                   EIEDAPLAAGVFGQWISFPDRDLVQIGQGVVGRDRTIAHELGHMVLGHRGLPIAEFAAE
FT                   HVQVVTPDLVARMLQRSCGSDDLAHAENGWPEDELAAERFAGMLLRRLGSGRGTRSRWS
FT                   HYLDDALG"
     MWFARRDASG HGAVVAAVDQ VLTISGQGSV VEVARNWAQA NGRVMEIEDA PLAAGVFGQW        60
     ISFPDRDLVQ IGQGVVGRDR TIAHELGHMV LGHRGLPIAE FAAEHVQVVT PDLVARMLQR       120
     SCGSDDLAHA ENGWPEDELA AERFAGMLLR RLGSGRGTRS RWSHYLDDAL G                171
//

If you have problems or comments...

PBIL Back to PBIL home page