(data stored in ACNUC30630 zone)

EMBL: CU458896.PE491

CU458896.PE491       Location/Qualifiers
FT   CDS             complement(493989..494411)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0495c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q7TVI6_MYCBO 5e-29"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0495c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60594"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGR0"
FT                   /protein_id="CAM60594.1"
FT                   /translation="MPDFSKRLSHLFATVHPAGRGPYSLNEVVAALGKRGVEVSSPYLS
FT                   LLRKGERSNPAPEIVTALAEFFQVSPAYFYDADYAESVNRDLDWLVQLRDSKVREIAQR
FT                   SYALSEHSRQAIADMVDHLRKVEGIPDKEAGNSASS"
     MPDFSKRLSH LFATVHPAGR GPYSLNEVVA ALGKRGVEVS SPYLSLLRKG ERSNPAPEIV        60
     TALAEFFQVS PAYFYDADYA ESVNRDLDWL VQLRDSKVRE IAQRSYALSE HSRQAIADMV       120
     DHLRKVEGIP DKEAGNSASS                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page