(data stored in ACNUC30630 zone)

EMBL: CU458896.PE536

CU458896.PE536       Location/Qualifiers
FT   CDS             541276..542256
FT                   /transl_table=11
FT                   /locus_tag="MAB_0540"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q278U2_MYCFV e-105"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60639"
FT                   /db_xref="GOA:B1MGV5"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGV5"
FT                   /protein_id="CAM60639.1"
FT                   /translation="MPEAFPVDGPVDGPVDDQSDGPLDGLRPARLAVGIISAGRVGTAL
FT                   GVALETAGHFVVACSAVSEASRRRAEQRLPESQILPAQEVAPRAELLILAVPDHELAAL
FT                   VAGLAATGSVRPGTIVVHTSGANGIAVLDPLTALGCMPLAIHPAMTFAGGDEDIERLPN
FT                   SCFGITAADEIGYAIGTALVLEIGGEPVRVREDARTLYHAALAHGSNHVVTLVLDAVEA
FT                   LRSALWGQELLGQETIGDGPGGLPERVLAPLVRAAVTNALDRGQAALTGPVARGDGAAI
FT                   GRHLDALMEADPALADAYRADARRTAQRAHAPQSVFSALEPRDAG"
     MPEAFPVDGP VDGPVDDQSD GPLDGLRPAR LAVGIISAGR VGTALGVALE TAGHFVVACS        60
     AVSEASRRRA EQRLPESQIL PAQEVAPRAE LLILAVPDHE LAALVAGLAA TGSVRPGTIV       120
     VHTSGANGIA VLDPLTALGC MPLAIHPAMT FAGGDEDIER LPNSCFGITA ADEIGYAIGT       180
     ALVLEIGGEP VRVREDARTL YHAALAHGSN HVVTLVLDAV EALRSALWGQ ELLGQETIGD       240
     GPGGLPERVL APLVRAAVTN ALDRGQAALT GPVARGDGAA IGRHLDALME ADPALADAYR       300
     ADARRTAQRA HAPQSVFSAL EPRDAG                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page