(data stored in ACNUC30630 zone)

EMBL: CU458896.PE545

CU458896.PE545       Location/Qualifiers
FT   CDS             complement(551313..552365)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0549c"
FT                   /product="Putative heme/hemin ABC transporter, permease
FT                   protein"
FT                   /note="Similar to Q9K469_STRCO 5e-82"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0549c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60648"
FT                   /db_xref="GOA:B1MGW4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGW4"
FT                   /protein_id="CAM60648.1"
FT                   /translation="MPTAQHTRSLILAVLGGLAALVLLTVTALAFGTADVPWRDCLHFL
FT                   WAGASGGSVPAVDAANYRIVVESRLPRVLLAVLVGAGLSVVGVIVQAMVRNALADPYVL
FT                   GISSGASVGATAVVVYGVLGTLGTYALSLSASLGALAATAVVYQIARTPQGLVPLRLVL
FT                   VGTAVGYGLSAVTTVLVFLAPNGEAARSVMFWLLGSLGASSWDKVPVALAATVIGILCA
FT                   GGLARQLNALAMGDEVSASLGLDAGRFRVALFILSAAMTGCFVSICGAVGFVGLVIPHA
FT                   ARLLVGADHRRVLIVAPVLGACFLVAADLVARTAIPPQELPLGAITAAVGVPVFVGLMR
FT                   RRAMSAGAVG"
     MPTAQHTRSL ILAVLGGLAA LVLLTVTALA FGTADVPWRD CLHFLWAGAS GGSVPAVDAA        60
     NYRIVVESRL PRVLLAVLVG AGLSVVGVIV QAMVRNALAD PYVLGISSGA SVGATAVVVY       120
     GVLGTLGTYA LSLSASLGAL AATAVVYQIA RTPQGLVPLR LVLVGTAVGY GLSAVTTVLV       180
     FLAPNGEAAR SVMFWLLGSL GASSWDKVPV ALAATVIGIL CAGGLARQLN ALAMGDEVSA       240
     SLGLDAGRFR VALFILSAAM TGCFVSICGA VGFVGLVIPH AARLLVGADH RRVLIVAPVL       300
     GACFLVAADL VARTAIPPQE LPLGAITAAV GVPVFVGLMR RRAMSAGAVG                  350
//

If you have problems or comments...

PBIL Back to PBIL home page