(data stored in ACNUC30630 zone)

EMBL: CU458896.PE558

CU458896.PE558       Location/Qualifiers
FT   CDS             564317..564865
FT                   /transl_table=11
FT                   /locus_tag="MAB_0563"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to O54133_STRCO 3e-20"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60661"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGX7"
FT                   /protein_id="CAM60661.1"
FT                   /translation="MSTWMSRSGEDRQHRMLPEGLEPVSRGPQAPAPGLELNPGWPRRF
FT                   SHPGTDADLWGTRFFAGAGAAVTGQFEVLPELEGGPGVIHGGVMAAIFDELQGILGIVT
FT                   QLIAVTAHLEIDYRKPIPVGSTVDLAAAVEGRTGRKLYTTASAHIDGELVASSQGIFVI
FT                   IDPDAHYGEGASRTLGISP"
     MSTWMSRSGE DRQHRMLPEG LEPVSRGPQA PAPGLELNPG WPRRFSHPGT DADLWGTRFF        60
     AGAGAAVTGQ FEVLPELEGG PGVIHGGVMA AIFDELQGIL GIVTQLIAVT AHLEIDYRKP       120
     IPVGSTVDLA AAVEGRTGRK LYTTASAHID GELVASSQGI FVIIDPDAHY GEGASRTLGI       180
     SP                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page