(data stored in ACNUC30630 zone)

EMBL: CU458896.PE561

CU458896.PE561       Location/Qualifiers
FT   CDS             complement(566777..567232)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0566c"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0566c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60664"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGY0"
FT                   /protein_id="CAM60664.1"
FT                   /translation="MKRLFTCVVAVATIGAMLSAPVAHAVPRTVTYRVWAEYGPLVAAT
FT                   IGYNDADGARRGAMNPQLPWGKDITWTDDTKHPLINVTGYNTGDGPRIYCQILIDGQVV
FT                   DEDDRVDLATCSYATDGVPREHCQRGNSGSVVGILSKVDGDPCSRNP"
     MKRLFTCVVA VATIGAMLSA PVAHAVPRTV TYRVWAEYGP LVAATIGYND ADGARRGAMN        60
     PQLPWGKDIT WTDDTKHPLI NVTGYNTGDG PRIYCQILID GQVVDEDDRV DLATCSYATD       120
     GVPREHCQRG NSGSVVGILS KVDGDPCSRN P                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page