(data stored in ACNUC30630 zone)

EMBL: CU458896.PE570

CU458896.PE570       Location/Qualifiers
FT   CDS             complement(574203..575033)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0575c"
FT                   /product="Putative ABC-transporter transmembrane protein"
FT                   /note="Similar to Q743V4_MYCPA 2e-68"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0575c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60673"
FT                   /db_xref="GOA:B1MGY9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGY9"
FT                   /protein_id="CAM60673.1"
FT                   /translation="MNNFFDLSLTADLLGRDFVQQAILAAALLGLLAGLIGPFVVMRQM
FT                   SFAVHGSSELSLTGAAAALLAGANVGTGALLGSVVAAILFGVLGQRTKDRDSSIGVVMA
FT                   FGLGLAVLFIHLYPGRTGTNFALLTGQIVGVGYSGLLMLVVVSMVVGAVLAVTYRPMLF
FT                   ATVDPDVAEARGVPVRALGIVFAALVGLTAAQGVQIVGALLVMSLLITPAAAAARITSS
FT                   PARAIALSIVFAEIAAIGGIMLSLAPGVPISVFVTMIAVAIYLLCRLVGRYRHA"
     MNNFFDLSLT ADLLGRDFVQ QAILAAALLG LLAGLIGPFV VMRQMSFAVH GSSELSLTGA        60
     AAALLAGANV GTGALLGSVV AAILFGVLGQ RTKDRDSSIG VVMAFGLGLA VLFIHLYPGR       120
     TGTNFALLTG QIVGVGYSGL LMLVVVSMVV GAVLAVTYRP MLFATVDPDV AEARGVPVRA       180
     LGIVFAALVG LTAAQGVQIV GALLVMSLLI TPAAAAARIT SSPARAIALS IVFAEIAAIG       240
     GIMLSLAPGV PISVFVTMIA VAIYLLCRLV GRYRHA                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page