(data stored in ACNUC30630 zone)

EMBL: CU458896.PE576

CU458896.PE576       Location/Qualifiers
FT   CDS             complement(582445..582744)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0581c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q741U3_MYCPA 5e-14"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0581c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60679"
FT                   /db_xref="UniProtKB/TrEMBL:B1MGZ5"
FT                   /protein_id="CAM60679.1"
FT                   /translation="MAAGTRSLRTDLRYLLVLHIHRHGLTTVSELVTMLADIGFDLDGR
FT                   PSKTVSDTLRTDVKLDRVRRRGRGLYSPGALPRSTQHRMRARTDKWSRLARQAE"
     MAAGTRSLRT DLRYLLVLHI HRHGLTTVSE LVTMLADIGF DLDGRPSKTV SDTLRTDVKL        60
     DRVRRRGRGL YSPGALPRST QHRMRARTDK WSRLARQAE                               99
//

If you have problems or comments...

PBIL Back to PBIL home page