(data stored in ACNUC30630 zone)

EMBL: CU458896.PE585

CU458896.PE585       Location/Qualifiers
FT   CDS             complement(591249..592520)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0590c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q8TNJ8_METAC e-108"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0590c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60688"
FT                   /db_xref="UniProtKB/TrEMBL:B1MH04"
FT                   /protein_id="CAM60688.1"
FT                   /translation="MPLHISDREREALAQVTRFPLLAALTGRRSRRFPAGGRIPAGPLA
FT                   YTSSEPITPISEVERALILSVVGGVTGWHYGITYHPGYAPAFPNYSGSATGRTFPSAAG
FT                   FHTSQLFFTDDTGIYLLPTRDEPPQEFSTIEQWITHTADSYVQISDKRLELPREEPYME
FT                   GHNIWIGNHPGSLLAFPVADLAEHLIANLSFFAANGYLVYDDINKQSIPGTEKFGGLRN
FT                   YDDPIPLSFVEQYTLTEASAELATATHNGVLLLQALGLGGWMFDGLDRLSVLGGSGDPR
FT                   APGIGFRSDNDDRWPFPNATGLPGYFETLSPPHVPTVADGVAKYIERKYGPGGPFHPDT
FT                   PGAWADSRKVRSAALPAEAVQEIVTVQASYIYDTFGKIPGTVPTVHTLMYLQAQNIDLG
FT                   FYDTYFGPGAYLPTHAEHARRWYG"
     MPLHISDRER EALAQVTRFP LLAALTGRRS RRFPAGGRIP AGPLAYTSSE PITPISEVER        60
     ALILSVVGGV TGWHYGITYH PGYAPAFPNY SGSATGRTFP SAAGFHTSQL FFTDDTGIYL       120
     LPTRDEPPQE FSTIEQWITH TADSYVQISD KRLELPREEP YMEGHNIWIG NHPGSLLAFP       180
     VADLAEHLIA NLSFFAANGY LVYDDINKQS IPGTEKFGGL RNYDDPIPLS FVEQYTLTEA       240
     SAELATATHN GVLLLQALGL GGWMFDGLDR LSVLGGSGDP RAPGIGFRSD NDDRWPFPNA       300
     TGLPGYFETL SPPHVPTVAD GVAKYIERKY GPGGPFHPDT PGAWADSRKV RSAALPAEAV       360
     QEIVTVQASY IYDTFGKIPG TVPTVHTLMY LQAQNIDLGF YDTYFGPGAY LPTHAEHARR       420
     WYG                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page