(data stored in ACNUC30630 zone)

EMBL: CU458896.PE652

CU458896.PE652       Location/Qualifiers
FT   CDS             659940..660992
FT                   /transl_table=11
FT                   /locus_tag="MAB_0657"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q267G6_MYCVN 8e-40"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0657"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60755"
FT                   /db_xref="GOA:B1MHT3"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHT3"
FT                   /protein_id="CAM60755.1"
FT                   /translation="MTFEPVLPWWMFIVLAVVIVALRMYTLYRVLVVVGGGSQRKVVLR
FT                   WSLLTLVIVSVFAAAARPGIEPTRHVLTESHAVAAANSNVNVFFVVDRSINSRAEDYGS
FT                   GQFRMAGIRADMDAVVNQYPQGRFSITSFATGARVDWPLSEDIWSLRALLKGYSAYVSE
FT                   LDSVYRVEVAAAADELRGQLELARRQYPGSSNVVFYLGEGAGASRQPAKSFDIPADLVD
FT                   GGAVLGYGTTDGGAVASQLAANGEKTYFQNAAGTGPFLSILDERSLKGIAEQLHVRYVH
FT                   RVQGDSIAPVIPALDPSAATSEQRSISLPGSRTEFYWVFTGIAMVLMFYELFAMVREYR
FT                   TSRITRVRPT"
     MTFEPVLPWW MFIVLAVVIV ALRMYTLYRV LVVVGGGSQR KVVLRWSLLT LVIVSVFAAA        60
     ARPGIEPTRH VLTESHAVAA ANSNVNVFFV VDRSINSRAE DYGSGQFRMA GIRADMDAVV       120
     NQYPQGRFSI TSFATGARVD WPLSEDIWSL RALLKGYSAY VSELDSVYRV EVAAAADELR       180
     GQLELARRQY PGSSNVVFYL GEGAGASRQP AKSFDIPADL VDGGAVLGYG TTDGGAVASQ       240
     LAANGEKTYF QNAAGTGPFL SILDERSLKG IAEQLHVRYV HRVQGDSIAP VIPALDPSAA       300
     TSEQRSISLP GSRTEFYWVF TGIAMVLMFY ELFAMVREYR TSRITRVRPT                  350
//

If you have problems or comments...

PBIL Back to PBIL home page