(data stored in ACNUC30630 zone)

EMBL: CU458896.PE662

CU458896.PE662       Location/Qualifiers
FT   CDS             670543..670767
FT                   /transl_table=11
FT                   /locus_tag="MAB_0667"
FT                   /product="Hypothetical heavy metal transport/detoxification
FT                   protein"
FT                   /note="Similar to Q4NJU7_9MICC 3e-06"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60765"
FT                   /db_xref="GOA:B1MHU3"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHU3"
FT                   /protein_id="CAM60765.1"
FT                   /translation="MSEQIFAISGMHCNSCVMGVTEALTALAPVREVSVDLDPKGASTV
FT                   RVLTDSVLSVEEVHDTLVRAGGDFAVAAG"
     MSEQIFAISG MHCNSCVMGV TEALTALAPV REVSVDLDPK GASTVRVLTD SVLSVEEVHD        60
     TLVRAGGDFA VAAG                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page