(data stored in ACNUC30630 zone)

EMBL: CU458896.PE665

CU458896.PE665       Location/Qualifiers
FT   CDS             673330..674367
FT                   /transl_table=11
FT                   /locus_tag="MAB_0670"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q5ZRG5_LEGPH 7e-82"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0670"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60768"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHU6"
FT                   /protein_id="CAM60768.1"
FT                   /translation="MSEYVWTVVGAGPAGIAAVGKLIDHGVLPASIAWIDPEFTAGDLG
FT                   AKWRAVPSNTSVKLFINYLTGADSFRFAHAPHFALNDLAPTDTCLLGDVADPLVWITGQ
FT                   LCAQVSALRTRATGLALHGGRWEVQTELGEITSKNVILAVGSVPKKLAYPWLNEIPIEV
FT                   ALDPAKLAEQPLEGATVAVFGASHSSMIALPNLLAGPAAKVINFYRGPLRYAVDMGEWT
FT                   LFDDTGLKGEAARWARENIDGVLPDRLQRCLVDSPEFPELLESCDYAVYTVGFSPRPIP
FT                   AAPQWGQLECNAANGIIAPGLFGVGIAFPEYRIDPTGFGEYRVGLQKFMDRLTKTLPLW
FT                   LKYGS"
     MSEYVWTVVG AGPAGIAAVG KLIDHGVLPA SIAWIDPEFT AGDLGAKWRA VPSNTSVKLF        60
     INYLTGADSF RFAHAPHFAL NDLAPTDTCL LGDVADPLVW ITGQLCAQVS ALRTRATGLA       120
     LHGGRWEVQT ELGEITSKNV ILAVGSVPKK LAYPWLNEIP IEVALDPAKL AEQPLEGATV       180
     AVFGASHSSM IALPNLLAGP AAKVINFYRG PLRYAVDMGE WTLFDDTGLK GEAARWAREN       240
     IDGVLPDRLQ RCLVDSPEFP ELLESCDYAV YTVGFSPRPI PAAPQWGQLE CNAANGIIAP       300
     GLFGVGIAFP EYRIDPTGFG EYRVGLQKFM DRLTKTLPLW LKYGS                       345
//

If you have problems or comments...

PBIL Back to PBIL home page