(data stored in ACNUC30630 zone)

EMBL: CU458896.PE696

CU458896.PE696       Location/Qualifiers
FT   CDS             complement(704513..705331)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0703c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q5Z135_NOCFA 8e-50"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0703c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60799"
FT                   /db_xref="GOA:B1MHX7"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHX7"
FT                   /protein_id="CAM60799.1"
FT                   /translation="MTVTIVAKEPVVSALAAEWSALDELGASLTDDQWATPSVLPGWTV
FT                   KDVVAHVVGTERLLSGDPIPSTDEAVTDLPHVRNPVGVLNERWLTYYRKLPPAAVMNDL
FT                   RTVTSARLAVLEGLSQEQFNAETATPVGPESYGRFMQIRDFDCWMHELDVRDSLGLPAP
FT                   TDPVTAAPALTELINALPFLIGKRAGAPQGSRIRFVLNGVGAQTVNIEIPDRARIVAAL
FT                   SEAPQVTLTADTCEFARHLGGRASANRNGFTLDGDPDLGWKIVANLRFTM"
     MTVTIVAKEP VVSALAAEWS ALDELGASLT DDQWATPSVL PGWTVKDVVA HVVGTERLLS        60
     GDPIPSTDEA VTDLPHVRNP VGVLNERWLT YYRKLPPAAV MNDLRTVTSA RLAVLEGLSQ       120
     EQFNAETATP VGPESYGRFM QIRDFDCWMH ELDVRDSLGL PAPTDPVTAA PALTELINAL       180
     PFLIGKRAGA PQGSRIRFVL NGVGAQTVNI EIPDRARIVA ALSEAPQVTL TADTCEFARH       240
     LGGRASANRN GFTLDGDPDL GWKIVANLRF TM                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page