(data stored in ACNUC30630 zone)

EMBL: CU458896.PE704

CU458896.PE704       Location/Qualifiers
FT   CDS             713466..713852
FT                   /transl_table=11
FT                   /locus_tag="MAB_0711"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q25WC1_MYCVN 2e-36"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0711"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60807"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHY5"
FT                   /protein_id="CAM60807.1"
FT                   /translation="MPARAPDAASTRTAVLAVADWLHGEQAPEPARAVLADAVRFTART
FT                   LAADAPGASVEVRVPPFVAVQCISGPRHTRGTPPNVVETTPRTWLLLVTGLLTLEQAIA
FT                   DRTVTVSGSRAAEIAEWLPLIPLS"
     MPARAPDAAS TRTAVLAVAD WLHGEQAPEP ARAVLADAVR FTARTLAADA PGASVEVRVP        60
     PFVAVQCISG PRHTRGTPPN VVETTPRTWL LLVTGLLTLE QAIADRTVTV SGSRAAEIAE       120
     WLPLIPLS                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page