(data stored in ACNUC30630 zone)

EMBL: CU458896.PE714

CU458896.PE714       Location/Qualifiers
FT   CDS             723626..724567
FT                   /transl_table=11
FT                   /locus_tag="MAB_0721"
FT                   /product="Probable oligopeptide ABC transporter, permease
FT                   protein"
FT                   /note="Similar to Q4NI76_9MICC 1e-81"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0721"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60817"
FT                   /db_xref="GOA:B1MHZ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHZ5"
FT                   /protein_id="CAM60817.1"
FT                   /translation="MTTSVSKPHGNRLRRLPGADLLRSVHGLQRWTLVVGLVLVAGFIA
FT                   IAVLAPVLAPYGFSQTSADGLDFVRQQAPSWQHWFGTSVRGEDVLSRVLFGARTALLVI
FT                   VTSLVVSLPAGVVLGLTSGYLGGWLDRALVLVMDALYAMPSLLLAIVVSIAVTGGQSST
FT                   GGGILAAAIAIMAVFVPQYFRVVRNATVGVKQEPFVDAARVTGAGTPRILFRHILSNVT
FT                   SSLPVIITLNGAEAILTLAGLGFLGFGIEPTQAAEWGYDLNKALSDVANGIWWTGVFPG
FT                   IAIVLVVLGMTLVGESLNEVINPLLRTRRGEA"
     MTTSVSKPHG NRLRRLPGAD LLRSVHGLQR WTLVVGLVLV AGFIAIAVLA PVLAPYGFSQ        60
     TSADGLDFVR QQAPSWQHWF GTSVRGEDVL SRVLFGARTA LLVIVTSLVV SLPAGVVLGL       120
     TSGYLGGWLD RALVLVMDAL YAMPSLLLAI VVSIAVTGGQ SSTGGGILAA AIAIMAVFVP       180
     QYFRVVRNAT VGVKQEPFVD AARVTGAGTP RILFRHILSN VTSSLPVIIT LNGAEAILTL       240
     AGLGFLGFGI EPTQAAEWGY DLNKALSDVA NGIWWTGVFP GIAIVLVVLG MTLVGESLNE       300
     VINPLLRTRR GEA                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page