(data stored in ACNUC30630 zone)

EMBL: CU458896.PE715

CU458896.PE715       Location/Qualifiers
FT   CDS             724564..726210
FT                   /transl_table=11
FT                   /locus_tag="MAB_0722"
FT                   /product="Putative oligopeptide ABC transporter,ATP-binding
FT                   protein"
FT                   /note="Similar to Q4NI77_9MICC e-141"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0722"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60818"
FT                   /db_xref="GOA:B1MHZ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1MHZ6"
FT                   /protein_id="CAM60818.1"
FT                   /translation="MSHVEASSALSFRSLSVTFSTDSGPVSAVDDVSFDVKPGEVLAVV
FT                   GESGSGKSVSSRTAIRLLPDTARITGSVLLDGRDVTKLSGRELAAMRGKDIAMVFQEPG
FT                   AALDPLFTIGYQVAEAVRAHSDMSRVQARARVIELLKLVRLPDPERRYDCYPHQLSGGQ
FT                   KQRVVIAIAIACDPKVIIADEPTTALDVTVQAEILELLRDLRDRIGSAIVLITHNMGVV
FT                   ADIADRVVVMKQGKVVEIAPVERLFAEPAEPYTRVLLAAVPHLGQGDPEHGAEPREDIG
FT                   EPVLEVSHLVVEFPGLLGRAAFRAVDDVSFGIGRGKTLGLVGESGSGKSTIGRCVAALQ
FT                   QPAAGSVRVLGQEIVGMSQRKLRPLRAKFGFVFQDPATALNPKMRVGDCIAEPMWVHRY
FT                   GDRGKIVARVAELIDAVQLPSGTENRYPHELSGGQRQRANLARALALGPDLLVADEPTS
FT                   ALDVSVQAAVLDLFEELQRQWRFACLFISHDLAVVDRLADEVAVLRHGVLEELGPRGEI
FT                   LHNPSRAYTRALVAAVPVPDPVKQRARRNGH"
     MSHVEASSAL SFRSLSVTFS TDSGPVSAVD DVSFDVKPGE VLAVVGESGS GKSVSSRTAI        60
     RLLPDTARIT GSVLLDGRDV TKLSGRELAA MRGKDIAMVF QEPGAALDPL FTIGYQVAEA       120
     VRAHSDMSRV QARARVIELL KLVRLPDPER RYDCYPHQLS GGQKQRVVIA IAIACDPKVI       180
     IADEPTTALD VTVQAEILEL LRDLRDRIGS AIVLITHNMG VVADIADRVV VMKQGKVVEI       240
     APVERLFAEP AEPYTRVLLA AVPHLGQGDP EHGAEPREDI GEPVLEVSHL VVEFPGLLGR       300
     AAFRAVDDVS FGIGRGKTLG LVGESGSGKS TIGRCVAALQ QPAAGSVRVL GQEIVGMSQR       360
     KLRPLRAKFG FVFQDPATAL NPKMRVGDCI AEPMWVHRYG DRGKIVARVA ELIDAVQLPS       420
     GTENRYPHEL SGGQRQRANL ARALALGPDL LVADEPTSAL DVSVQAAVLD LFEELQRQWR       480
     FACLFISHDL AVVDRLADEV AVLRHGVLEE LGPRGEILHN PSRAYTRALV AAVPVPDPVK       540
     QRARRNGH                                                                548
//

If you have problems or comments...

PBIL Back to PBIL home page