(data stored in ACNUC30630 zone)

EMBL: CU458896.PE726

CU458896.PE726       Location/Qualifiers
FT   CDS             737127..737633
FT                   /transl_table=11
FT                   /locus_tag="MAB_0733"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q277E2_MYCFV 2e-40"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0733"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60829"
FT                   /db_xref="UniProtKB/TrEMBL:B1MI07"
FT                   /protein_id="CAM60829.1"
FT                   /translation="MAGAVLAAFAVVPVANAQPPKFPDVDSYPAVDLAEYQVIGAHPSM
FT                   SGWVFSTPGGLRCQSNMIADLGVSCTGPIVGAATDMNSVAVSLTKPGLIARYEQSPDDH
FT                   SYPLLPTGSKIAPGNGVVCAVLADDALACRAKKPDSWPKDTQDPPDRHYGEHGFVVQPS
FT                   GSWSY"
     MAGAVLAAFA VVPVANAQPP KFPDVDSYPA VDLAEYQVIG AHPSMSGWVF STPGGLRCQS        60
     NMIADLGVSC TGPIVGAATD MNSVAVSLTK PGLIARYEQS PDDHSYPLLP TGSKIAPGNG       120
     VVCAVLADDA LACRAKKPDS WPKDTQDPPD RHYGEHGFVV QPSGSWSY                    168
//

If you have problems or comments...

PBIL Back to PBIL home page