(data stored in ACNUC30630 zone)

EMBL: CU458896.PE737

CU458896.PE737       Location/Qualifiers
FT   CDS             744288..745094
FT                   /transl_table=11
FT                   /locus_tag="MAB_0744"
FT                   /product="Probable transcriptional regulatory protein"
FT                   /note="Similar to Q5Z298_NOCFA 4e-92"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0744"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60840"
FT                   /db_xref="GOA:B1MI18"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1MI18"
FT                   /protein_id="CAM60840.1"
FT                   /translation="MLEGSLDLLLLTADPNPDGVLPSLSLLAHTVRPVPSEVSSLLEAG
FT                   AADVAIVDARTDLASARGLCRLLGAAGSSVPVVAVVNEGSLVAVNVDWGLDDILLPGTG
FT                   PAEIDARLRLLVGRRAGAVNVENASKVVLGELVIDEGTYTARLRGRPLDLTYKEFELLK
FT                   YLAQHAGRVFTRAQLLQEVWGYDFFGGTRTVDVHVRRLRAKLGGEYESLIGTVRNVGYK
FT                   AVRPPRAKGEPGPSAADDDDESDIDDLDDDGTDQDIASEPGAINAG"
     MLEGSLDLLL LTADPNPDGV LPSLSLLAHT VRPVPSEVSS LLEAGAADVA IVDARTDLAS        60
     ARGLCRLLGA AGSSVPVVAV VNEGSLVAVN VDWGLDDILL PGTGPAEIDA RLRLLVGRRA       120
     GAVNVENASK VVLGELVIDE GTYTARLRGR PLDLTYKEFE LLKYLAQHAG RVFTRAQLLQ       180
     EVWGYDFFGG TRTVDVHVRR LRAKLGGEYE SLIGTVRNVG YKAVRPPRAK GEPGPSAADD       240
     DDESDIDDLD DDGTDQDIAS EPGAINAG                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page