(data stored in ACNUC30630 zone)

EMBL: CU458896.PE79

CU458896.PE79        Location/Qualifiers
FT   CDS             complement(79114..79803)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0082c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q740C0_MYCPA 3e-67"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0082c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60182"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEB8"
FT                   /protein_id="CAM60182.1"
FT                   /translation="MAAISSPGEPNLAATSWTILGMLSYEEEVSGYDIKKWADWSISYF
FT                   YWSPSFSQVYSELRKLEKIGYATSRVDHDNGARSRRLYKITPAGMAAMSQWANETPAEP
FT                   QVLKHSVVLRVMQGHMTDPARLKEILERHIEYAENMQRRAALDAAGAAAQPAWAYSRVA
FT                   LKWAERYYAAERDLAMMMIEDLAEAAEEFDKAGPDGGTPRLVPGYWREVEKRVDAEKLS
FT                   TQHDTAD"
     MAAISSPGEP NLAATSWTIL GMLSYEEEVS GYDIKKWADW SISYFYWSPS FSQVYSELRK        60
     LEKIGYATSR VDHDNGARSR RLYKITPAGM AAMSQWANET PAEPQVLKHS VVLRVMQGHM       120
     TDPARLKEIL ERHIEYAENM QRRAALDAAG AAAQPAWAYS RVALKWAERY YAAERDLAMM       180
     MIEDLAEAAE EFDKAGPDGG TPRLVPGYWR EVEKRVDAEK LSTQHDTAD                   229
//

If you have problems or comments...

PBIL Back to PBIL home page