(data stored in ACNUC8465 zone)

EMBL: CU928166.PE100

CU928166.PE100       Location/Qualifiers
FT   CDS             complement(204902..205501)
FT                   /locus_tag="KLTH0B02618g"
FT                   /old_locus_tag="KLTH-ORF15652"
FT                   /product="KLTH0B02618p"
FT                   /note="similar to uniprot|Q07915 Saccharomyces cerevisiae
FT                   YLR009W RLP24 Ribosomal Like Protein 24"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02618g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21465"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF4"
FT                   /protein_id="CAR21465.1"
FT                   /translation="MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRN
FT                   PRKLRWTKAFRKAAGKELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQKRE
FT                   RAFYKNRMRGNKEREFLRDRQLVEKNPELLNMRDVELLRTAERAERVEAASDAESEEMD
FT                   VDSESEHESEDESEAEAQKQKVVLTNKRKVGKKIAF"
     MRVYSCHFCS SPCYPGHGIM FVRNDAKEFR FCRSKCHKNF KQRRNPRKLR WTKAFRKAAG        60
     KELAVDSTLA FAQRRNVPVR YNRELVATTL RAMARVEEIR QKRERAFYKN RMRGNKEREF       120
     LRDRQLVEKN PELLNMRDVE LLRTAERAER VEAASDAESE EMDVDSESEH ESEDESEAEA       180
     QKQKVVLTNK RKVGKKIAF                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page