(data stored in SCRATCH zone)

EMBL: CU928166.PE102

CU928166.PE102       Location/Qualifiers
FT   CDS             complement(206266..207135)
FT                   /locus_tag="KLTH0B02662g"
FT                   /old_locus_tag="KLTH-ORF15647"
FT                   /product="KLTH0B02662p"
FT                   /note="weakly similar to uniprot|Q07913 Saccharomyces
FT                   cerevisiae YLR007W NSE1 Essential nuclear protein required
FT                   for DNA repair forms a complex with Smc5p and Rhc18p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02662g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21467"
FT                   /db_xref="GOA:C5DCF6"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="InterPro:IPR014857"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF6"
FT                   /protein_id="CAR21467.1"
FT                   /translation="MEVDAVREESGGDEAQLSYEDKGKFLLQYVLSRRGVCSEKALAKA
FT                   LKTLERDGEQLEDSETEAQVVKMVGRLNVRLSALDYKLVRQRDQLGAWMYAYVDVSPSG
FT                   DTKLATPLTIEELKYVQWCVREMLEAGQEVAEARGAKSAVERSVDEALVQSGSGRDELS
FT                   AEFDSKSLRFRVSYTAGARQLFQFDDLGPLETERLLTRLCQLRWFYRTNEGHFGLATRA
FT                   LSELQEYLRTQYTVPVCTVCDEVALRGVKCQCAEGAWHAPCFQHYVAHVSNACARCERP
FT                   VLEAIYMA"
     MEVDAVREES GGDEAQLSYE DKGKFLLQYV LSRRGVCSEK ALAKALKTLE RDGEQLEDSE        60
     TEAQVVKMVG RLNVRLSALD YKLVRQRDQL GAWMYAYVDV SPSGDTKLAT PLTIEELKYV       120
     QWCVREMLEA GQEVAEARGA KSAVERSVDE ALVQSGSGRD ELSAEFDSKS LRFRVSYTAG       180
     ARQLFQFDDL GPLETERLLT RLCQLRWFYR TNEGHFGLAT RALSELQEYL RTQYTVPVCT       240
     VCDEVALRGV KCQCAEGAWH APCFQHYVAH VSNACARCER PVLEAIYMA                   289
//

If you have problems or comments...

PBIL Back to PBIL home page