(data stored in SCRATCH zone)

EMBL: CU928166.PE103

CU928166.PE103       Location/Qualifiers
FT   CDS             207260..209047
FT                   /locus_tag="KLTH0B02684g"
FT                   /old_locus_tag="KLTH-ORF15644"
FT                   /product="KLTH0B02684p"
FT                   /note="some similarities with uniprot|Q07084 Saccharomyces
FT                   cerevisiae YLR006C SSK1 Cytoplasmic response regulator part
FT                   of a two-component signal transducer that mediates
FT                   osmosensing via a phosphorelay mechanism dephosphorylated
FT                   form is degraded by the ubiquitin-proteasome system
FT                   potential Cdc28p substrate"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02684g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21468"
FT                   /db_xref="GOA:C5DCF7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF7"
FT                   /protein_id="CAR21468.1"
FT                   /translation="MAQKVGFRSPVPSPSGLAVQVPHKEIRLKVWVRLDSQKLPPDTIN
FT                   QATAIEFEREDTIDDLKDRIFRRFRDTRWAQENDSFGIAIGCWCECGFGATSAGDLKDL
FT                   LLQPVPNMASNAAPIDLSHAPPYIRRTSRTCSPHAATLGTPPSYSPHPAHPSYNKLQCS
FT                   TQSSTPLAQLRLSVGAGNKELGGGMDGCALSPVRLGSARRLSRTATPAVGEVDPDSIPH
FT                   QSLLEPDELVFNVCKNLFGGVAAQTANDALVVFSNNPDIPLFDETMDGAPMVEDLTDYK
FT                   LVVDEEQLRKLSHTNDEENIDCPKQAILLLPRGFEGDVNLPSPNVATPSASSPPALEEV
FT                   SPGAAISPTQRVSPVLMTSAPLVEEEIGLVPPRDPIVQREGSPFILSAMESVTTESITR
FT                   DKVFPKISVLVVEDNMINQAILSSFLRKHKIHYKVAKNGVEAVDRWKEGGMHLILMDLE
FT                   MPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTE
FT                   ALLAGCNDYLTKPVNLDWLTRKITEWGCMQALIDFDDWKDNDERLNSCIEQKAKASQKT
FT                   TSTSNASKSTNLNKRITTS"
     MAQKVGFRSP VPSPSGLAVQ VPHKEIRLKV WVRLDSQKLP PDTINQATAI EFEREDTIDD        60
     LKDRIFRRFR DTRWAQENDS FGIAIGCWCE CGFGATSAGD LKDLLLQPVP NMASNAAPID       120
     LSHAPPYIRR TSRTCSPHAA TLGTPPSYSP HPAHPSYNKL QCSTQSSTPL AQLRLSVGAG       180
     NKELGGGMDG CALSPVRLGS ARRLSRTATP AVGEVDPDSI PHQSLLEPDE LVFNVCKNLF       240
     GGVAAQTAND ALVVFSNNPD IPLFDETMDG APMVEDLTDY KLVVDEEQLR KLSHTNDEEN       300
     IDCPKQAILL LPRGFEGDVN LPSPNVATPS ASSPPALEEV SPGAAISPTQ RVSPVLMTSA       360
     PLVEEEIGLV PPRDPIVQRE GSPFILSAME SVTTESITRD KVFPKISVLV VEDNMINQAI       420
     LSSFLRKHKI HYKVAKNGVE AVDRWKEGGM HLILMDLEMP LLSGIDAAKE IRKLEKQNGI       480
     GTGDPLGKHA ELKGLTCKAP VIIVALTASN SQTDKTEALL AGCNDYLTKP VNLDWLTRKI       540
     TEWGCMQALI DFDDWKDNDE RLNSCIEQKA KASQKTTSTS NASKSTNLNK RITTS            595
//

If you have problems or comments...

PBIL Back to PBIL home page