(data stored in ACNUC8465 zone)

EMBL: CU928166.PE107

CU928166.PE107       Location/Qualifiers
FT   CDS             214541..217132
FT                   /locus_tag="KLTH0B02772g"
FT                   /old_locus_tag="KLTH-ORF15629"
FT                   /product="KLTH0B02772p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02772g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21472"
FT                   /db_xref="GOA:C5DCG1"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG1"
FT                   /protein_id="CAR21472.1"
FT                   /translation="MNVLLSFLALSKFFLLAIAVPVRDDDLYTEMVEAQLDEEFEEQVE
FT                   RTEVRSSGFESSPGATGRALFGLSDGLFEEFPFLNYVDVFYGTEGGGHMFPGTTVPFGM
FT                   CKMGVDVLHPHSTDAYSGYHSTGDVCGISMLHESGTGGSPTYGVVSQLPLMASSASDVD
FT                   TSRQIAFPRSKPDAGHIGYYRVSLSNRVTIEFSSNSRSGLYKYTFPTKHQQHHMSPIVM
FT                   VNVTQHLHSVKRPWWTQNFEGGYIKVDKSYKSYRGKAYFSGGWSDPGTWSVSFYGVFDK
FT                   PAKRVRAFHGSKAYNRLRLNLAKSLNSNMGMLFEFEKGTKVLYSHVGVSFSETDGINVA
FT                   RQNLALNYPEENMFDLHWSVRSTAEAWDNEVFSKVNIDESKEDPIIVEKMYNALYGSHL
FT                   MPSDKSGREAPWPTNEPYYDDWFTLWDTFRCLHPLLNILNTKRSADMTRSLIEIWRKEG
FT                   YMPDGRSASRSGRTQGGSNADIVLADAFVKGVGEGVDWQDGFSAMRSNADKSPEYILDK
FT                   AAPDSTNKYGRGALNDWLELGYITRRFSRSVTRTMEYAYNDFALSVVAEGLGYFELAKQ
FT                   YLKRSSNWQNIWNFEATTPEYDYSGFIQPKDSNGNFIEKKYNPLSCFGCYWRDDEYEGK
FT                   PIEYGWAVPHDIQSLKEFIGPDELFMRRLDDMFDLYGDGIADIGNEPSFLTPYLFNFIN
FT                   AQYRTSETLGYLIDHKFLLGPKGLPGNSDAGAMQAWLWFGLVGFYPIAGTDIYLITSPK
FT                   ITELEIQLEGNGKALIQAHNLYAEDADSEYDYDKAHSSFTRNLYISSVELNGKLINRNW
FT                   FTHEELFGSNGGLLVFTMTDEPTFWDADGEYPPSRGHFQRDDIERPNRLVD"
     MNVLLSFLAL SKFFLLAIAV PVRDDDLYTE MVEAQLDEEF EEQVERTEVR SSGFESSPGA        60
     TGRALFGLSD GLFEEFPFLN YVDVFYGTEG GGHMFPGTTV PFGMCKMGVD VLHPHSTDAY       120
     SGYHSTGDVC GISMLHESGT GGSPTYGVVS QLPLMASSAS DVDTSRQIAF PRSKPDAGHI       180
     GYYRVSLSNR VTIEFSSNSR SGLYKYTFPT KHQQHHMSPI VMVNVTQHLH SVKRPWWTQN       240
     FEGGYIKVDK SYKSYRGKAY FSGGWSDPGT WSVSFYGVFD KPAKRVRAFH GSKAYNRLRL       300
     NLAKSLNSNM GMLFEFEKGT KVLYSHVGVS FSETDGINVA RQNLALNYPE ENMFDLHWSV       360
     RSTAEAWDNE VFSKVNIDES KEDPIIVEKM YNALYGSHLM PSDKSGREAP WPTNEPYYDD       420
     WFTLWDTFRC LHPLLNILNT KRSADMTRSL IEIWRKEGYM PDGRSASRSG RTQGGSNADI       480
     VLADAFVKGV GEGVDWQDGF SAMRSNADKS PEYILDKAAP DSTNKYGRGA LNDWLELGYI       540
     TRRFSRSVTR TMEYAYNDFA LSVVAEGLGY FELAKQYLKR SSNWQNIWNF EATTPEYDYS       600
     GFIQPKDSNG NFIEKKYNPL SCFGCYWRDD EYEGKPIEYG WAVPHDIQSL KEFIGPDELF       660
     MRRLDDMFDL YGDGIADIGN EPSFLTPYLF NFINAQYRTS ETLGYLIDHK FLLGPKGLPG       720
     NSDAGAMQAW LWFGLVGFYP IAGTDIYLIT SPKITELEIQ LEGNGKALIQ AHNLYAEDAD       780
     SEYDYDKAHS SFTRNLYISS VELNGKLINR NWFTHEELFG SNGGLLVFTM TDEPTFWDAD       840
     GEYPPSRGHF QRDDIERPNR LVD                                               863
//

If you have problems or comments...

PBIL Back to PBIL home page