(data stored in SCRATCH zone)

EMBL: CU928166.PE110

CU928166.PE110       Location/Qualifiers
FT   CDS             223097..225583
FT                   /locus_tag="KLTH0B02860g"
FT                   /old_locus_tag="KLTH-ORF15618"
FT                   /product="KLTH0B02860p"
FT                   /note="some similarities with uniprot|P20840 Saccharomyces
FT                   cerevisiae YJR004C SAG1 Alpha-agglutinin of alpha-cells
FT                   binds to Aga1p during agglutination N-terminal half is
FT                   homologous to the immunoglobulin superfamily and contains
FT                   binding site for a-agglutinin C-terminal half is highly
FT                   glycosylated and contains GPI anchor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02860g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21475"
FT                   /db_xref="GOA:C5DCG4"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR024672"
FT                   /db_xref="InterPro:IPR033504"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG4"
FT                   /protein_id="CAR21475.1"
FT                   /translation="MLCRMLALVLATSFFLGHTLATQIKSVSFEGLSIDSISSQSFPHK
FT                   MWELSFEFTIEDVNQISESDYFLLDLPHVYRVKFSNDADYQYITMADGSDAFKCYASQQ
FT                   AAYKYGSSVLRCDAVRTFSSFTSLRGNLSIGAVFSNGGSSYEFELENSKYFKSGEQLVE
FT                   LSEKLSAVANFARAPDFDSYYYEGRTTTYGSMESYYLGLSCPDGYILGGTQVIDYSPGT
FT                   QPSSFDCSDAQVQLSSDFNDWFFPESYQSFSGDYVCNGATLSISFDKIDSGKRIWVNNL
FT                   QYLDASASTVYHSIYFDYTCTNTLSSLVYTTAVHQSPAFVIKDGVFTGSAVVDALSTSA
FT                   ILTTTTTTTTTWKSAYATTTTGSVSSGATVITIHVDTPGTSSTQSFSSSRSDSSESIIA
FT                   STSSDFSKPTTSTLTVTSCVSNRCSKLELISPSTSSIVSIVTSSPSESSTSPSESSTPS
FT                   SASSTSPSESSTPSSASSTSSSVSSTPSSVSSTPSSVSSTPSSESSTSPSESSTSPSES
FT                   TTSTPITTFANRTSAPPSTGHYSSTISTPGFPSSARGSQSISFGTVPFTELSYSVSTSR
FT                   PSSLVLTSTTLKSTSPTSSLSGSSPCLGTACFETVSFVKPSDSSPPSHPASTSSTRPTM
FT                   QTGTTTMEFQTSSSSISASKFTDSKLLSSGGVSKATSSFSESTAATWKVTSSITKSTAS
FT                   SLDKSIVTTPSLTTNIIKSSETGTQSDLASSDSSQVERPGSSNGGVITSTTHLSKASSN
FT                   AFLGSIAASSFSSSSDSATTTTKVSAQITSTPSLVLSSTSAFSSASFSVYEGLAARHKF
FT                   QVTLGALASLVLYSFT"
     MLCRMLALVL ATSFFLGHTL ATQIKSVSFE GLSIDSISSQ SFPHKMWELS FEFTIEDVNQ        60
     ISESDYFLLD LPHVYRVKFS NDADYQYITM ADGSDAFKCY ASQQAAYKYG SSVLRCDAVR       120
     TFSSFTSLRG NLSIGAVFSN GGSSYEFELE NSKYFKSGEQ LVELSEKLSA VANFARAPDF       180
     DSYYYEGRTT TYGSMESYYL GLSCPDGYIL GGTQVIDYSP GTQPSSFDCS DAQVQLSSDF       240
     NDWFFPESYQ SFSGDYVCNG ATLSISFDKI DSGKRIWVNN LQYLDASAST VYHSIYFDYT       300
     CTNTLSSLVY TTAVHQSPAF VIKDGVFTGS AVVDALSTSA ILTTTTTTTT TWKSAYATTT       360
     TGSVSSGATV ITIHVDTPGT SSTQSFSSSR SDSSESIIAS TSSDFSKPTT STLTVTSCVS       420
     NRCSKLELIS PSTSSIVSIV TSSPSESSTS PSESSTPSSA SSTSPSESST PSSASSTSSS       480
     VSSTPSSVSS TPSSVSSTPS SESSTSPSES STSPSESTTS TPITTFANRT SAPPSTGHYS       540
     STISTPGFPS SARGSQSISF GTVPFTELSY SVSTSRPSSL VLTSTTLKST SPTSSLSGSS       600
     PCLGTACFET VSFVKPSDSS PPSHPASTSS TRPTMQTGTT TMEFQTSSSS ISASKFTDSK       660
     LLSSGGVSKA TSSFSESTAA TWKVTSSITK STASSLDKSI VTTPSLTTNI IKSSETGTQS       720
     DLASSDSSQV ERPGSSNGGV ITSTTHLSKA SSNAFLGSIA ASSFSSSSDS ATTTTKVSAQ       780
     ITSTPSLVLS STSAFSSASF SVYEGLAARH KFQVTLGALA SLVLYSFT                    828
//

If you have problems or comments...

PBIL Back to PBIL home page